Antibody data

Product number
ABIN630921
Provider
antibodies-online
Product name
anti-Proteasome (Prosome, Macropain) Subunit, beta Type, 3 (PSMB3) antibody
Provider product page
antibodies-online - ABIN630921
Antibody type
Polyclonal
Antigen
PSMB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
Description
Affinity purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles.
Provider Type Product Number
- No reagents -