H00005691-M

PSMB3 antibody from Abnova Corporation
HC10-II, MGC4147
No application information provided.

Antibody data

Product number
H00005691-M
Provider
Abnova Corporation
Product name
PSMB3 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00005691-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PSMB3.
Antigen sequence
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMV
TTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFR
LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYT
EPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSG
TCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAV
DRDAVSGMGVIVHIIEKDKITTRTLKARMD
Provider Type Product Number
- No reagents -