H00083593-B01P

RASSF5 antibody from Abnova Corporation
Maxp1, NORE1, RAPL

Antibody data

Product number
H00083593-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083593-B01P, RRID:AB_1579597
Product name
RASSF5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00083593-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RASSF5 protein.
Antigen sequence
MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQS
KHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK
NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRP
QSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS
STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDG
QVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE
TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKK
YDKFRQKLEEALRESQGKPG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -