HPA000449

ESR1 antibody from Atlas Antibodies
Era, ESR, NR3A1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA000449
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000449, RRID:AB_611464
Product name
Anti-ESR1
Provider product page
Atlas Antibodies - HPA000449
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQP
HGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRR
QGGRERLASTNDKGSMAMESAKETRYCAVCNDYAS
GYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCT
ID
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -