HPA000450

ESR1 antibody from Sigma-Aldrich
Era, ESR, NR3A1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000450
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000450, RRID:AB_1078754
Product name
Anti-ESR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000450
Antibody type
Polyclonal
Antigen
Estrogen receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDH
IHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLL
ILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEML
DAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSL
QKYYIT
Storage
-20C
Provider Type Product Number
- No reagents -