Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [2]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001383 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001383, RRID:AB_1078500
- Product name
- Anti-ERBB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPRE
GPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGG
AVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWD
QDPPERGAPPSTFKGTPTA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The HER2-encoded miR-4728-3p regulates ESR1 through a non-canonical internal seed interaction.
Progesterone receptor negativity is an independent risk factor for relapse in patients with early stage endometrioid endometrial adenocarcinoma
Newie I, Søkilde R, Persson H, Grabau D, Rego N, Kvist A, von Stedingk K, Axelson H, Borg Å, Vallon-Christersson J, Rovira C
PloS one 2014;9(5):e97200
PloS one 2014;9(5):e97200
Progesterone receptor negativity is an independent risk factor for relapse in patients with early stage endometrioid endometrial adenocarcinoma
Huvila J, Talve L, Carpén O, Edqvist P, Pontén F, Grénman S, Auranen A
Gynecologic Oncology 2013 September;130(3):463-469
Gynecologic Oncology 2013 September;130(3):463-469
2011-04-12
- Submitted by
- hallworth
- Comment
- Average quality in multiple assays...
- Antibody rating
- 3. Good
- Image
- Submitted by
- hallworth
- Comment
- Very good antibody
- Antibody rating
- 5. Excellent
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows moderate membranous and cytoplasmic positivity in urothelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected.
- Sample type
- HUMAN