HPA001383

ERBB2 antibody from Atlas Antibodies
CD340, HER-2, HER2, NEU, NGL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001383
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001383, RRID:AB_1078500
Product name
Anti-ERBB2
Provider product page
Atlas Antibodies - HPA001383
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPRE
GPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGG
AVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWD
QDPPERGAPPSTFKGTPTA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -