HPA001383

ERBB2 antibody from Sigma-Aldrich
CD340, HER-2, HER2, NEU, NGL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001383
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001383, RRID:AB_1078500
Product name
Anti-ERBB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001383
Antibody type
Polyclonal
Antigen
Receptor tyrosine-protein kinase erbB-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPRE
GPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGG
AVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWD
QDPPERGAPPSTFKGTPTA
Storage
-20C
Provider Type Product Number
- No reagents -