Antibody data

Product number
ABIN502330
Provider
antibodies-online
Product name
anti-Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2) antibody
Provider product page
antibodies-online - ABIN502330
Antibody type
Polyclonal
Antigen
The immunogen for anti-UBE2D2 antibody: synthetic peptide directed towards the middle region of human UBE2D2
Reactivity
Human, Mouse, Rat, Porcine
Host
Rabbit
Antigen sequence
TIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
TRIYH PNINSNGSIC
Vial size
50 µg
Provider Type Product Number
- No reagents -