Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000764 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000764, RRID:AB_1079700
- Product name
- Anti-KLK3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS
EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEP
EEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFML
CAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSE
PCA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MicroRNA expression signature of castration-resistant prostate cancer: the microRNA-221/222 cluster functions as a tumour suppressor and disease progression marker.
Single-cell clones of liver cancer stem cells have the potential of differentiating into different types of tumor cells.
GAD1 is a biomarker for benign and malignant prostatic tissue
Goto Y, Kojima S, Nishikawa R, Kurozumi A, Kato M, Enokida H, Matsushita R, Yamazaki K, Ishida Y, Nakagawa M, Naya Y, Ichikawa T, Seki N
British journal of cancer 2015 Sep 29;113(7):1055-65
British journal of cancer 2015 Sep 29;113(7):1055-65
Single-cell clones of liver cancer stem cells have the potential of differentiating into different types of tumor cells.
Liu H, Zhang W, Jia Y, Yu Q, Grau GE, Peng L, Ran Y, Yang Z, Deng H, Lou J
Cell death & disease 2013 Oct 17;4(10):e857
Cell death & disease 2013 Oct 17;4(10):e857
GAD1 is a biomarker for benign and malignant prostatic tissue
Jaraj S, Augsten M, Häggarth L, Wester K, Pontén F, Östman A, Egevad L
Scandinavian Journal of Urology and Nephrology 2010 September;45(1):39-45
Scandinavian Journal of Urology and Nephrology 2010 September;45(1):39-45
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN