HPA000764

KLK3 antibody from Atlas Antibodies
APS, PSA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000764
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000764, RRID:AB_1079700
Product name
Anti-KLK3
Provider product page
Atlas Antibodies - HPA000764
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS
EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEP
EEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFML
CAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSE
PCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -