HPA000764

KLK3 antibody from Sigma-Aldrich
APS, PSA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000764
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000764, RRID:AB_1079700
Product name
Anti-KLK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000764
Antibody type
Polyclonal
Antigen
Prostate-specific antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLS
EPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEP
EEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFML
CAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSE
PCA
Storage
-20C
Provider Type Product Number
- No reagents -