Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004864-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004864-M02, RRID:AB_464159
- Product name
- NPC1 monoclonal antibody (M02), clone 4H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NPC1.
- Antigen sequence
GFANAMYNACRDVEAPSSNDKALGLLCGKDADACN
ATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPM
NNATKGCDESVDEVTAPCSCQDCSIVCGPK- Isotype
- IgG
- Antibody clone number
- 4H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer.
Lund RR, Leth-Larsen R, Caterino TD, Terp MG, Nissen J, Lænkholm AV, Jensen ON, Ditzel HJ
Molecular & cellular proteomics : MCP 2015 Nov;14(11):2988-99
Molecular & cellular proteomics : MCP 2015 Nov;14(11):2988-99
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NPC1 monoclonal antibody (M02), clone 4H2. Western Blot analysis of NPC1 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NPC1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol