HPA001202

RNF139 antibody from Atlas Antibodies
HRCA1, RCA1, TRC8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001202
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001202, RRID:AB_1079824
Product name
Anti-RNF139
Provider product page
Atlas Antibodies - HPA001202
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYF
HALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVS
NNNGFIPPNETPEEAVREAAAESDRELNEDDSTDC
DDDVQRERNGVIQHTGAAAEEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -