HPA001202

RNF139 antibody from Sigma-Aldrich
HRCA1, RCA1, TRC8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001202
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001202, RRID:AB_1079824
Product name
Anti-RNF139 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001202
Antibody type
Polyclonal
Antigen
RING finger protein 139 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYF
HALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVS
NNNGFIPPNETPEEAVREAAAESDRELNEDDSTDC
DDDVQRERNGVIQHTGAAAEEF
Storage
-20C
Provider Type Product Number
- No reagents -