H00009939-M08

RBM8A antibody from Abnova Corporation
BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP

Antibody data

Product number
H00009939-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009939-M08, RRID:AB_1237845
Product name
RBM8A monoclonal antibody (M08), clone 3E4
Provider product page
Abnova Corporation - H00009939-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RBM8A.
Antigen sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKR
KGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLN
LDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Isotype
IgG
Antibody clone number
3E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -