HPA018403

RBM8A antibody from Sigma-Aldrich
BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018403
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018403, RRID:AB_1858908
Product name
Anti-RBM8A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018403
Antibody type
Polyclonal
Antigen
RNA-binding protein 8A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKR
KGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILFV
Storage
-20C
Provider Type Product Number
- No reagents -