HPA018403

RBM8A antibody from Atlas Antibodies
BOV-1A, BOV-1B, BOV-1C, RBM8, RBM8B, Y14, ZNRP

Antibody data

Product number
HPA018403
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018403, RRID:AB_1858908
Product name
Anti-RBM8A
Provider product page
Atlas Antibodies - HPA018403
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKR
KGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILFV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.