HPA001473

CASP9 antibody from Atlas Antibodies
APAF-3, ICE-LAP6, MCH6, PPP1R56
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001473
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001473, RRID:AB_1078401
Product name
Anti-CASP9
Provider product page
Atlas Antibodies - HPA001473
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALESLRGNADLAYILSMEPCGHCLIINNVNFCRES
GLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAK
KMVLALLELAQQDHGALDCCVVVILSHGCQASHLQ
FPGAVYGTDGCPVSVEKIVNIFNGTSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -