HPA001473

CASP9 antibody from Sigma-Aldrich
APAF-3, ICE-LAP6, MCH6, PPP1R56
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001473
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001473, RRID:AB_1078401
Product name
Anti-CASP9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001473
Antibody type
Polyclonal
Antigen
Caspase-9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALESLRGNADLAYILSMEPCGHCLIINNVNFCRES
GLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAK
KMVLALLELAQQDHGALDCCVVVILSHGCQASHLQ
FPGAVYGTDGCPVSVEKIVNIFNGTSC
Storage
-20C
Provider Type Product Number
- No reagents -