HPA001328

antibody from Atlas Antibodies

Targeting: BRAF BRAF1

Western blot

Antibody data

Submit

Validation data

Product number: HPA001328 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001328, RRID:AB_1078296
Product name: Anti-BRAF
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTS PSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPN VHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPP ASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRM KTLGRRDSS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BRAF protein structure - HPA001328 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using HPA001328 antibody. Corresponding BRAF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in distal tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colorectal cancer shows moderate cytoplasmic positivity in tumor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
Sample type: HUMAN