HPA001328

BRAF antibody from Sigma-Aldrich
BRAF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001328
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001328, RRID:AB_1078296
Product name
Anti-BRAF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001328
Antibody type
Polyclonal
Antigen
B-Raf proto-oncogene serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTS
PSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPN
VHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPP
ASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRM
KTLGRRDSS
Storage
-20C
Provider Type Product Number
- No reagents -