Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- WH0000673M1 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Monoclonal Anti-BRAF antibody produced in mouse
- Antibody type
- Monoclonal
- Antigen
- BRAF (NP_004324, a.a. 346-445) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
- Description
- ascites fluid
- Reactivity
- Human
- Antigen sequence
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNID
DLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKA
LQKSPGPQRERKSSSSSEDRNRMKTLGRRD (wit
hout GST)- Isotype
- IgM
- Storage
- -20C
Submitted references RAF inhibitors prime wild-type RAF to activate the MAPK pathway and enhance growth
Georgia Hatzivassiliou, Kyung Song, Ivana Yen, Barbara J. Brandhuber, Daniel J. Anderson, Ryan Alvarado, Mary J. C. Ludlam, David Stokoe, Susan L. Gloor, Guy Vigers, Tony Morales, Ignacio Aliagas, Bonnie Liu, Steve Sideris, Klaus P. Hoeflich, Bijay S. Jaiswal, Somasekar Seshagiri, Hartmut Koeppen, Marcia Belvin, Lori S. Friedman, Shiva Malek
Nature 2010 Feb;464(7287):431-435
Nature 2010 Feb;464(7287):431-435
No comments: Submit comment
No validations: Submit validation data