Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310195 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Complement C2 (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQ
KTKES LGRKIQIQRS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association analysis of CFH, C2, BF, and HTRA1 gene polymorphisms in Chinese patients with polypoidal choroidal vasculopathy.
Lee KY, Vithana EN, Mathur R, Yong VH, Yeo IY, Thalamuthu A, Lee MW, Koh AH, Lim MC, How AC, Wong DW, Aung T
Investigative ophthalmology & visual science 2008 Jun;49(6):2613-9
Investigative ophthalmology & visual science 2008 Jun;49(6):2613-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting