Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003315 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003315, RRID:AB_1078639
- Product name
- Anti-DCN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGL
NNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNN
KLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCP
PGHNTKKASYSGVSLFSNPVQY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Decreased decorin expression in the tumor microenvironment.
Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer.
Proteomic analyses reveal high expression of decorin and endoplasmin (HSP90B1) are associated with breast cancer metastasis and decreased survival.
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Bozoky B, Savchenko A, Guven H, Ponten F, Klein G, Szekely L
Cancer medicine 2014 Jun;3(3):485-91
Cancer medicine 2014 Jun;3(3):485-91
Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer.
Henke A, Grace OC, Ashley GR, Stewart GD, Riddick AC, Yeun H, O'Donnell M, Anderson RA, Thomson AA
PloS one 2012;7(8):e42516
PloS one 2012;7(8):e42516
Proteomic analyses reveal high expression of decorin and endoplasmin (HSP90B1) are associated with breast cancer metastasis and decreased survival.
Cawthorn TR, Moreno JC, Dharsee M, Tran-Thanh D, Ackloo S, Zhu PH, Sardana G, Chen J, Kupchak P, Jacks LM, Miller NA, Youngson BJ, Iakovlev V, Guidos CJ, Vallis KA, Evans KR, McCready D, Leong WL, Done SJ
PloS one 2012;7(2):e30992
PloS one 2012;7(2):e30992
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Edlund K, Lindskog C, Saito A, Berglund A, Pontén F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Östman A, Micke P
International Journal of Cancer 2012 November;131(10):2264-2273
International Journal of Cancer 2012 November;131(10):2264-2273
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and DCN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403339).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human ovary and cerebral cortex tissues using Anti-DCN antibody. Corresponding DCN RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human ovary shows extracellular positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human ovary shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN