HPA003315

DCN antibody from Sigma-Aldrich
DSPG2, SLRR1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003315, RRID:AB_1078639
Product name
Anti-DCN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003315
Antibody type
Polyclonal
Antigen
Decorin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGL
NNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNN
KLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCP
PGHNTKKASYSGVSLFSNPVQY
Storage
-20C
Provider Type Product Number
- No reagents -