HPA003239

PCMT1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003239
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003239, RRID:AB_1079580
Product name
Anti-PCMT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003239
Antibody type
Polyclonal
Antigen
Protein-L-isoaspartate(D-aspartate) O-methyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKE
LVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAE
EAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVG
PAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDK
EKQWS
Storage
-20C
Provider Type Product Number
- No reagents -