HPA000927

SERPINA1 antibody from Atlas Antibodies
A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000927
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000927, RRID:AB_1844761
Product name
Anti-SERPINA1
Provider product page
Atlas Antibodies - HPA000927
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI
FFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLT
EIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFL
SEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKK
QINDYGAPHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -