HPA000927
antibody from Atlas Antibodies
Targeting: SERPINA1
A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000927 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000927, RRID:AB_1844761
- Product name
- Anti-SERPINA1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI
FFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLT
EIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFL
SEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKK
QINDYGAPHR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Snail and serpinA1 promote tumor progression and predict prognosis in colorectal cancer
Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer.
Kwon C, Park H, Choi J, Lee J, Kim H, Jo H, Kim H, Oh N, Song G, Park D
Oncotarget 2015 August;6(24):20312-20326
Oncotarget 2015 August;6(24):20312-20326
Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer.
Kwon CH, Park HJ, Lee JR, Kim HK, Jeon TY, Jo HJ, Kim DH, Kim GH, Park DY
British journal of cancer 2014 Nov 11;111(10):1993-2002
British journal of cancer 2014 Nov 11;111(10):1993-2002
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-SERPINA1 antibody HPA000927 (A) shows similar pattern to independent antibody HPA001292 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and cerebral cortex tissues using Anti-SERPINA1 antibody. Corresponding SERPINA1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human liver, lung, lymph node and testis using Anti-SERPINA1 antibody HPA000927 (A) shows similar protein distribution across tissues to independent antibody HPA001292 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate extra-cellular positivity in cells in tubules and positivity of plasma in blood vessel.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-SERPINA1 antibody HPA000927.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung using Anti-SERPINA1 antibody HPA000927.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-SERPINA1 antibody HPA000927.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-SERPINA1 antibody HPA000927.
- Sample type
- HUMAN