HPA001292

SERPINA1 antibody from Sigma-Aldrich
A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001292
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001292, RRID:AB_1844762
Product name
Anti-SERPINA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001292
Antibody type
Polyclonal
Antigen
alpha-1-antitrypsin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGK
LQHLENELTHDIITKFLENEDRRSASLHLPKLSIT
GTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKL
SKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEV
KFNKPFVFLMGAPHR
Storage
-20C
Provider Type Product Number
- No reagents -