Antibody data
- Antibody Data
- Antigen structure
- References [32]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000875-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000875-M01, RRID:AB_490007
- Product name
- CBS monoclonal antibody (M01), clone 3E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CBS.
- Antigen sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPED
KEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP
AKSPKILPDILKKIGDTPMVRINKIGKKFG- Isotype
- IgG
- Antibody clone number
- 3E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decreased expression of cystathionine β-synthase promotes glioma tumorigenesis.
Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling.
Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway.
Hypoxia-inducible factors regulate human and rat cystathionine β-synthase gene expression.
Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons.
Hydrogen sulfide attenuates opioid dependence by suppression of adenylate cyclase/cAMP pathway.
Downregulation of cystathionine β-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type.
Actions of hydrogen sulfide and ATP-sensitive potassium channels on colonic hypermotility in a rat model of chronic stress.
Sensitization of sodium channels by cystathionine β-synthetase activation in colon sensory neurons in adult rats with neonatal maternal deprivation.
Promoted interaction of nuclear factor-κB with demethylated cystathionine-β-synthetase gene contributes to gastric hypersensitivity in diabetic rats.
Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2.
Electroacupuncture suppresses mechanical allodynia and nuclear factor κ B signaling in streptozotocin-induced diabetic rats.
Hydrogen sulphide-induced relaxation of porcine peripheral bronchioles.
Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe.
Hydrogen sulfide producing enzymes in pregnancy and preeclampsia.
Hydrogen sulfide modulates contractile function in rat jejunum.
Interdependency of cystathione γ-lyase and cystathione β-synthase in hydrogen sulfide-induced blood pressure regulation in rats.
Characterization of hydrogen sulfide and its synthases, cystathionine β-synthase and cystathionine γ-lyase, in human prostatic tissue and cells.
Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation.
Placental markers of folate-related metabolism in preeclampsia.
Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine β-synthase.
Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes.
A crucial role for hydrogen sulfide in oxygen sensing via modulating large conductance calcium-activated potassium channels.
Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract.
The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction.
Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide.
Actions of hydrogen sulphide on ion transport across rat distal colon.
Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats.
The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome.
Active cystathionine beta-synthase can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone.
Hydrogen sulfide enhances ulcer healing in rats.
Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon.
Takano N, Sarfraz Y, Gilkes DM, Chaturvedi P, Xiang L, Suematsu M, Zagzag D, Semenza GL
Molecular cancer research : MCR 2014 Oct;12(10):1398-406
Molecular cancer research : MCR 2014 Oct;12(10):1398-406
Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling.
Ida T, Sawa T, Ihara H, Tsuchiya Y, Watanabe Y, Kumagai Y, Suematsu M, Motohashi H, Fujii S, Matsunaga T, Yamamoto M, Ono K, Devarie-Baez NO, Xian M, Fukuto JM, Akaike T
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7606-11
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7606-11
Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway.
Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, Kamata A, Sakamoto K, Nakanishi T, Kubo A, Hishiki T, Suematsu M
Nature communications 2014 Mar 17;5:3480
Nature communications 2014 Mar 17;5:3480
Hypoxia-inducible factors regulate human and rat cystathionine β-synthase gene expression.
Takano N, Peng YJ, Kumar GK, Luo W, Hu H, Shimoda LA, Suematsu M, Prabhakar NR, Semenza GL
The Biochemical journal 2014 Mar 1;458(2):203-11
The Biochemical journal 2014 Mar 1;458(2):203-11
Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons.
Miyamoto R, Otsuguro K, Yamaguchi S, Ito S
Journal of neurochemistry 2014 Jul;130(1):29-40
Journal of neurochemistry 2014 Jul;130(1):29-40
Hydrogen sulfide attenuates opioid dependence by suppression of adenylate cyclase/cAMP pathway.
Yang HY, Wu ZY, Wood M, Whiteman M, Bian JS
Antioxidants & redox signaling 2014 Jan 1;20(1):31-41
Antioxidants & redox signaling 2014 Jan 1;20(1):31-41
Downregulation of cystathionine β-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type.
Du C, Jin M, Hong Y, Li Q, Wang XH, Xu JM, Wang F, Zhang Y, Jia J, Liu CF, Hu LF
Biochemical and biophysical research communications 2014 Aug 22;451(2):239-45
Biochemical and biophysical research communications 2014 Aug 22;451(2):239-45
Actions of hydrogen sulfide and ATP-sensitive potassium channels on colonic hypermotility in a rat model of chronic stress.
Liu Y, Luo H, Liang C, Xia H, Xu W, Chen J, Chen M
PloS one 2013;8(2):e55853
PloS one 2013;8(2):e55853
Sensitization of sodium channels by cystathionine β-synthetase activation in colon sensory neurons in adult rats with neonatal maternal deprivation.
Hu S, Xu W, Miao X, Gao Y, Zhu L, Zhou Y, Xiao Y, Xu GY
Experimental neurology 2013 Oct;248:275-85
Experimental neurology 2013 Oct;248:275-85
Promoted interaction of nuclear factor-κB with demethylated cystathionine-β-synthetase gene contributes to gastric hypersensitivity in diabetic rats.
Zhang HH, Hu J, Zhou YL, Hu S, Wang YM, Chen W, Xiao Y, Huang LY, Jiang X, Xu GY
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 May 22;33(21):9028-38
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 May 22;33(21):9028-38
Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2.
Yang G, Zhao K, Ju Y, Mani S, Cao Q, Puukila S, Khaper N, Wu L, Wang R
Antioxidants & redox signaling 2013 May 20;18(15):1906-19
Antioxidants & redox signaling 2013 May 20;18(15):1906-19
Electroacupuncture suppresses mechanical allodynia and nuclear factor κ B signaling in streptozotocin-induced diabetic rats.
Shi L, Zhang HH, Xiao Y, Hu J, Xu GY
CNS neuroscience & therapeutics 2013 Feb;19(2):83-90
CNS neuroscience & therapeutics 2013 Feb;19(2):83-90
Hydrogen sulphide-induced relaxation of porcine peripheral bronchioles.
Rashid S, Heer JK, Garle MJ, Alexander SP, Roberts RE
British journal of pharmacology 2013 Apr;168(8):1902-10
British journal of pharmacology 2013 Apr;168(8):1902-10
Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe.
Dufton N, Natividad J, Verdu EF, Wallace JL
Scientific reports 2012;2:499
Scientific reports 2012;2:499
Hydrogen sulfide producing enzymes in pregnancy and preeclampsia.
Holwerda KM, Bos EM, Rajakumar A, Ris-Stalpers C, van Pampus MG, Timmer A, Erwich JJ, Faas MM, van Goor H, Lely AT
Placenta 2012 Jun;33(6):518-21
Placenta 2012 Jun;33(6):518-21
Hydrogen sulfide modulates contractile function in rat jejunum.
Kasparek MS, Linden DR, Farrugia G, Sarr MG
The Journal of surgical research 2012 Jun 15;175(2):234-42
The Journal of surgical research 2012 Jun 15;175(2):234-42
Interdependency of cystathione γ-lyase and cystathione β-synthase in hydrogen sulfide-induced blood pressure regulation in rats.
Roy A, Khan AH, Islam MT, Prieto MC, Majid DS
American journal of hypertension 2012 Jan;25(1):74-81
American journal of hypertension 2012 Jan;25(1):74-81
Characterization of hydrogen sulfide and its synthases, cystathionine β-synthase and cystathionine γ-lyase, in human prostatic tissue and cells.
Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J
Urology 2012 Feb;79(2):483.e1-5
Urology 2012 Feb;79(2):483.e1-5
Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation.
Streeter E, Al-Magableh M, Hart JL, Badoer E
Frontiers in physiology 2011;2:55
Frontiers in physiology 2011;2:55
Placental markers of folate-related metabolism in preeclampsia.
Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya M
Reproduction (Cambridge, England) 2011 Sep;142(3):467-76
Reproduction (Cambridge, England) 2011 Sep;142(3):467-76
Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine β-synthase.
Yamamoto T, Takano N, Ishiwata K, Suematsu M
Journal of clinical biochemistry and nutrition 2011 Jan;48(1):96-100
Journal of clinical biochemistry and nutrition 2011 Jan;48(1):96-100
Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes.
Majtan T, Liu L, Carpenter JF, Kraus JP
The Journal of biological chemistry 2010 May 21;285(21):15866-73
The Journal of biological chemistry 2010 May 21;285(21):15866-73
A crucial role for hydrogen sulfide in oxygen sensing via modulating large conductance calcium-activated potassium channels.
Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, Jiang LH, Rong W
Antioxidants & redox signaling 2010 May 15;12(10):1179-89
Antioxidants & redox signaling 2010 May 15;12(10):1179-89
Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract.
Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2010 Feb;42(2):103-9
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2010 Feb;42(2):103-9
The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction.
Predmore BL, Alendy MJ, Ahmed KI, Leeuwenburgh C, Julian D
Age (Dordrecht, Netherlands) 2010 Dec;32(4):467-81
Age (Dordrecht, Netherlands) 2010 Dec;32(4):467-81
Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide.
Lee M, Schwab C, Yu S, McGeer E, McGeer PL
Neurobiology of aging 2009 Oct;30(10):1523-34
Neurobiology of aging 2009 Oct;30(10):1523-34
Actions of hydrogen sulphide on ion transport across rat distal colon.
Hennig B, Diener M
British journal of pharmacology 2009 Nov;158(5):1263-75
British journal of pharmacology 2009 Nov;158(5):1263-75
Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats.
Wallace JL, Vong L, McKnight W, Dicay M, Martin GR
Gastroenterology 2009 Aug;137(2):569-78, 578.e1
Gastroenterology 2009 Aug;137(2):569-78, 578.e1
The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome.
Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ
Molecular pain 2009 Aug 6;5:44
Molecular pain 2009 Aug 6;5:44
Active cystathionine beta-synthase can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone.
Majtan T, Singh LR, Wang L, Kruger WD, Kraus JP
The Journal of biological chemistry 2008 Dec 12;283(50):34588-95
The Journal of biological chemistry 2008 Dec 12;283(50):34588-95
Hydrogen sulfide enhances ulcer healing in rats.
Wallace JL, Dicay M, McKnight W, Martin GR
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Dec;21(14):4070-6
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Dec;21(14):4070-6
Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon.
Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M
Gastroenterology 2006 Nov;131(5):1542-52
Gastroenterology 2006 Nov;131(5):1542-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1.Lane 1: CBS transfected lysate(61 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CBS monoclonal antibody (M01), clone 3E1. Western Blot analysis of CBS expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CBS is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CBS MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol