Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [12]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000875-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000875-A01, RRID:AB_461505
- Product name
- CBS polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length recombinant CBS.
- Antigen sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPED
KEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP
AKSPKILPDILKKIGDTPMVRINKIGKKFGLKCEL
LAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGD
TIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSS
EKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRL
KNEIPNSHILDQYRNASNPLAHYDTTADEILQQCD
GKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGV
DPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVL
DRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSA
GSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKF
LSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVI
LGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQI
RLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSS
QRQMVFGVVTAIDLLNFVAAQERDQK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hydrogen Sulfide Is a Novel Regulator of Bone Formation Implicated in the Bone Loss Induced by Estrogen Deficiency.
Cystathionine β-synthase regulates endothelial function via protein S-sulfhydration.
Folic acid deficiency induces premature hearing loss through mechanisms involving cochlear oxidative stress and impairment of homocysteine metabolism.
Arsenite-induced changes in hepatic protein abundance in cynomolgus monkeys (Macaca fascicularis).
Cystathionine beta-synthase (CBS) contributes to advanced ovarian cancer progression and drug resistance.
Correction of cystathionine β-synthase deficiency in mice by treatment with proteasome inhibitors.
Surrogate genetics and metabolic profiling for characterization of human disease alleles.
Ischemia/reperfusion reduces transcription factor Sp1-mediated cystathionine beta-synthase expression in the kidney.
Activation of mutant enzyme function in vivo by proteasome inhibitors and treatments that induce Hsp70.
Hydrogen sulfide as a mediator of human corpus cavernosum smooth-muscle relaxation.
Functional rescue of mutant human cystathionine beta-synthase by manipulation of Hsp26 and Hsp70 levels in Saccharomyces cerevisiae.
Hydrogen sulphide reduces insulin secretion from HIT-T15 cells by a KATP channel-dependent pathway.
Grassi F, Tyagi AM, Calvert JW, Gambari L, Walker LD, Yu M, Robinson J, Li JY, Lisignoli G, Vaccaro C, Adams J, Pacifici R
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 May;31(5):949-63
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research 2016 May;31(5):949-63
Cystathionine β-synthase regulates endothelial function via protein S-sulfhydration.
Saha S, Chakraborty PK, Xiong X, Dwivedi SK, Mustafi SB, Leigh NR, Ramchandran R, Mukherjee P, Bhattacharya R
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2016 Jan;30(1):441-56
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2016 Jan;30(1):441-56
Folic acid deficiency induces premature hearing loss through mechanisms involving cochlear oxidative stress and impairment of homocysteine metabolism.
Martínez-Vega R, Garrido F, Partearroyo T, Cediel R, Zeisel SH, Martínez-Álvarez C, Varela-Moreiras G, Varela-Nieto I, Pajares MA
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2015 Feb;29(2):418-32
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2015 Feb;29(2):418-32
Arsenite-induced changes in hepatic protein abundance in cynomolgus monkeys (Macaca fascicularis).
Kim S, Lee SH, Lee S, Park JD, Ryu DY
Proteomics 2014 Aug;14(15):1833-43
Proteomics 2014 Aug;14(15):1833-43
Cystathionine beta-synthase (CBS) contributes to advanced ovarian cancer progression and drug resistance.
Bhattacharyya S, Saha S, Giri K, Lanza IR, Nair KS, Jennings NB, Rodriguez-Aguayo C, Lopez-Berestein G, Basal E, Weaver AL, Visscher DW, Cliby W, Sood AK, Bhattacharya R, Mukherjee P
PloS one 2013;8(11):e79167
PloS one 2013;8(11):e79167
Correction of cystathionine β-synthase deficiency in mice by treatment with proteasome inhibitors.
Gupta S, Wang L, Anderl J, Slifker MJ, Kirk C, Kruger WD
Human mutation 2013 Aug;34(8):1085-93
Human mutation 2013 Aug;34(8):1085-93
Surrogate genetics and metabolic profiling for characterization of human disease alleles.
Mayfield JA, Davies MW, Dimster-Denk D, Pleskac N, McCarthy S, Boydston EA, Fink L, Lin XX, Narain AS, Meighan M, Rine J
Genetics 2012 Apr;190(4):1309-23
Genetics 2012 Apr;190(4):1309-23
Ischemia/reperfusion reduces transcription factor Sp1-mediated cystathionine beta-synthase expression in the kidney.
Wu N, Siow YL, O K
The Journal of biological chemistry 2010 Jun 11;285(24):18225-33
The Journal of biological chemistry 2010 Jun 11;285(24):18225-33
Activation of mutant enzyme function in vivo by proteasome inhibitors and treatments that induce Hsp70.
Singh LR, Gupta S, Honig NH, Kraus JP, Kruger WD
PLoS genetics 2010 Jan;6(1):e1000807
PLoS genetics 2010 Jan;6(1):e1000807
Hydrogen sulfide as a mediator of human corpus cavernosum smooth-muscle relaxation.
d'Emmanuele di Villa Bianca R, Sorrentino R, Maffia P, Mirone V, Imbimbo C, Fusco F, De Palma R, Ignarro LJ, Cirino G
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 17;106(11):4513-8
Proceedings of the National Academy of Sciences of the United States of America 2009 Mar 17;106(11):4513-8
Functional rescue of mutant human cystathionine beta-synthase by manipulation of Hsp26 and Hsp70 levels in Saccharomyces cerevisiae.
Singh LR, Kruger WD
The Journal of biological chemistry 2009 Feb 13;284(7):4238-45
The Journal of biological chemistry 2009 Feb 13;284(7):4238-45
Hydrogen sulphide reduces insulin secretion from HIT-T15 cells by a KATP channel-dependent pathway.
Ali MY, Whiteman M, Low CM, Moore PK
The Journal of endocrinology 2007 Oct;195(1):105-12
The Journal of endocrinology 2007 Oct;195(1):105-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CBS polyclonal antibody (A01), Lot # NUS1051025QCS1 Western Blot analysis of CBS expression in K-562 ( Cat # L009V1 ).
