Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000875-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000875-M06, RRID:AB_1111713
- Product name
- CBS monoclonal antibody (M06), clone 6A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CBS.
- Antigen sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPED
KEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAP
AKSPKILPDILKKIGDTPMVRINKIGKKFG- Isotype
- IgG
- Antibody clone number
- 6A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Sex-specific dysregulation of cysteine oxidation and the methionine and folate cycles in female cystathionine gamma-lyase null mice: a serendipitous model of the methylfolate trap.
Purification and characterization of cystathionine β-synthase bearing a cobalt protoporphyrin.
Jiang H, Hurt KJ, Breen K, Stabler SP, Allen RH, Orlicky DJ, Maclean KN
Biology open 2015 Aug 14;4(9):1154-62
Biology open 2015 Aug 14;4(9):1154-62
Purification and characterization of cystathionine β-synthase bearing a cobalt protoporphyrin.
Majtan T, Freeman KM, Smith AT, Burstyn JN, Kraus JP
Archives of biochemistry and biophysics 2011 Apr 1;508(1):25-30
Archives of biochemistry and biophysics 2011 Apr 1;508(1):25-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CBS is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CBS on HeLa cell . [antibody concentration 20 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol