Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310723 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cystathionine-beta-Synthase (CBS) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFD
SPESH VGVAWRLKNE- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hepatic metabolite profiles in mice with a suboptimal selenium status.
Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: roles of L-cysteine, cystathionine β-synthase, and K+ channels.
Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism.
Cystathionine beta synthase expression in mouse retina.
Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck.
The p.T191M mutation of the CBS gene is highly prevalent among homocystinuric patients from Spain, Portugal and South America.
Geillinger KE, Rathmann D, Köhrle J, Fiamoncini J, Daniel H, Kipp AP
The Journal of nutritional biochemistry 2014 Sep;25(9):914-22
The Journal of nutritional biochemistry 2014 Sep;25(9):914-22
Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: roles of L-cysteine, cystathionine β-synthase, and K+ channels.
Yamane S, Kanno T, Nakamura H, Fujino H, Murayama T
European journal of pharmacology 2014 Oct 5;740:112-20
European journal of pharmacology 2014 Oct 5;740:112-20
Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism.
Dahlhoff C, Desmarchelier C, Sailer M, Fürst RW, Haag A, Ulbrich SE, Hummel B, Obeid R, Geisel J, Bader BL, Daniel H
PloS one 2013;8(3):e57387
PloS one 2013;8(3):e57387
Cystathionine beta synthase expression in mouse retina.
Markand S, Tawfik A, Ha Y, Gnana-Prakasam J, Sonne S, Ganapathy V, Sen N, Xian M, Smith SB
Current eye research 2013 May;38(5):597-604
Current eye research 2013 May;38(5):597-604
Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck.
Fernandes VS, Ribeiro AS, Martínez MP, Orensanz LM, Barahona MV, Martínez-Sáenz A, Recio P, Benedito S, Bustamante S, Carballido J, García-Sacristán A, Prieto D, Hernández M
The Journal of urology 2013 Apr;189(4):1567-73
The Journal of urology 2013 Apr;189(4):1567-73
The p.T191M mutation of the CBS gene is highly prevalent among homocystinuric patients from Spain, Portugal and South America.
Urreizti R, Asteggiano C, Bermudez M, Córdoba A, Szlago M, Grosso C, de Kremer RD, Vilarinho L, D'Almeida V, Martínez-Pardo M, Peña-Quintana L, Dalmau J, Bernal J, Briceño I, Couce ML, Rodés M, Vilaseca MA, Balcells S, Grinberg D
Journal of human genetics 2006;51(4):305-13
Journal of human genetics 2006;51(4):305-13
No comments: Submit comment
No validations: Submit validation data