HPA001223

CBS antibody from Sigma-Aldrich
HIP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001223
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001223, RRID:AB_1846112
Product name
Anti-CBS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001223
Antibody type
Polyclonal
Antigen
Cystathionine beta-synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGN
TGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRAL
GAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHI
LDQYRNASNPLAHYDTTADEILQQCDGKLDMLVAS
VGTGGTITGIGAPHR
Storage
-20C
Provider Type Product Number
- No reagents -