Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003553-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003553-M01, RRID:AB_606446
- Product name
- IL1B monoclonal antibody (M01), clone 2A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IL1B.
- Antigen sequence
DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPK
NYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIS
TSQAENMPVFLGGTKGGQDITDFTMQFVSS- Isotype
- IgG
- Antibody clone number
- 2A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Upregulation of MMP-13 via Runx2 in the stromal cell of Giant Cell Tumor of bone.
Mak IW, Cowan RW, Popovic S, Colterjohn N, Singh G, Ghert M
Bone 2009 Aug;45(2):377-86
Bone 2009 Aug;45(2):377-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IL1B monoclonal antibody (M01), clone 2A8. Western Blot analysis of IL1B expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IL1B is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to IL1B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of IL1B transfected lysate using anti-IL1B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL1B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol