Antibody data

Product number
H00003553-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003553-M06, RRID:AB_1237748
Product name
IL1B monoclonal antibody (M06), clone 2E8
Provider product page
Abnova Corporation - H00003553-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant IL1B.
Antigen sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCS
FQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVA
MDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFF
DTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPY
ELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKK
MEKRFVFNKIEINNKLEFESAQFPNWYISTSQAEN
MPVFLGGTKGGQDITDFTMQFVSS
Isotype
IgG
Antibody clone number
2E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -