Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003553-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003553-D01P, RRID:AB_1576278
- Product name
- IL1B purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human IL1B protein.
- Antigen sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCS
FQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVA
MDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFF
DTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPY
ELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKK
MEKRFVFNKIEINNKLEFESAQFPNWYISTSQAEN
MPVFLGGTKGGQDITDFTMQFVSS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ginger phenylpropanoids inhibit IL-1beta and prostanoid secretion and disrupt arachidonate-phospholipid remodeling by targeting phospholipases A2.
Nievergelt A, Marazzi J, Schoop R, Altmann KH, Gertsch J
Journal of immunology (Baltimore, Md. : 1950) 2011 Oct 15;187(8):4140-50
Journal of immunology (Baltimore, Md. : 1950) 2011 Oct 15;187(8):4140-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of IL1B expression in transfected 293T cell line (H00003553-T01) by IL1B MaxPab polyclonal antibody.Lane 1: IL1B transfected lysate(30.70 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IL1B MaxPab rabbit polyclonal antibody. Western Blot analysis of IL1B expression in mouse testis.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)