ABIN503515

IL1B antibody from antibodies-online
IL-1B, IL1-BETA, IL1F2
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN503515
Provider
antibodies-online
Product name
anti-Interleukin 1, beta (IL1B) (N-Term) antibody
Provider product page
antibodies-online - ABIN503515
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL1B antibody: synthetic peptide directed towards the N terminal of human IL1B
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMD
KLRKM LVPCPQTFQE
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -