Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503515 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 1, beta (IL1B) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL1B antibody: synthetic peptide directed towards the N terminal of human IL1B
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMD
KLRKM LVPCPQTFQE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ATP is released by monocytes stimulated with pathogen-sensing receptor ligands and induces IL-1beta and IL-18 secretion in an autocrine way.
Piccini A, Carta S, Tassi S, LasigliƩ D, Fossati G, Rubartelli A
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 10;105(23):8067-72
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 10;105(23):8067-72
No comments: Submit comment
No validations: Submit validation data