HPA001939

MMP2 antibody from Atlas Antibodies
CLG4, CLG4A, TBE-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001939
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001939, RRID:AB_1079395
Product name
Anti-MMP2
Provider product page
Atlas Antibodies - HPA001939
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIA
QIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWP
ELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLE
RGYPKPLTSLGLPPDVQRVDAAFNWS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -