Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019965 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DGCR8
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPA
VRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTG
AERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGI
GGESADKKDEENELDQEKRVEYAVLDELEDFTDNL
ELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFD
NDVDAL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Predominant Distribution of the RNAi Machinery at Apical Adherens Junctions in Colonic Epithelia Is Disrupted in Cancer
Sequestration of DROSHA and DGCR8 by Expanded CGG RNA Repeats Alters MicroRNA Processing in Fragile X-Associated Tremor/Ataxia Syndrome
Nair-Menon J, Daulagala A, Connor D, Rutledge L, Penix T, Bridges M, Wellslager B, Spyropoulos D, Timmers C, Broome A, Kourtidis A
International Journal of Molecular Sciences 2020;21(7):2559
International Journal of Molecular Sciences 2020;21(7):2559
Sequestration of DROSHA and DGCR8 by Expanded CGG RNA Repeats Alters MicroRNA Processing in Fragile X-Associated Tremor/Ataxia Syndrome
Sellier C, Freyermuth F, Tabet R, Tran T, He F, Ruffenach F, Alunni V, Moine H, Thibault C, Page A, Tassone F, Willemsen R, Disney M, Hagerman P, Todd P, Charlet-Berguerand N
Cell Reports 2013;3(3):869-880
Cell Reports 2013;3(3):869-880
No comments: Submit comment
No validations: Submit validation data