Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405369 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DiGeorge Syndrome Critical Region Gene 8 (DGCR8) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DGCR8 antibody: synthetic peptide directed towards the N terminal of human DGCR8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEE
GAGGF TAKAIVQRDR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Localization and sub-cellular shuttling of HTLV-1 tax with the miRNA machinery.
NMDA mediated contextual conditioning changes miRNA expression.
Nucleolar localization of DGCR8 and identification of eleven DGCR8-associated proteins.
Van Duyne R, Guendel I, Klase Z, Narayanan A, Coley W, Jaworski E, Roman J, Popratiloff A, Mahieux R, Kehn-Hall K, Kashanchi F
PloS one 2012;7(7):e40662
PloS one 2012;7(7):e40662
NMDA mediated contextual conditioning changes miRNA expression.
Kye MJ, Neveu P, Lee YS, Zhou M, Steen JA, Sahin M, Kosik KS, Silva AJ
PloS one 2011;6(9):e24682
PloS one 2011;6(9):e24682
Nucleolar localization of DGCR8 and identification of eleven DGCR8-associated proteins.
Shiohama A, Sasaki T, Noda S, Minoshima S, Shimizu N
Experimental cell research 2007 Dec 10;313(20):4196-207
Experimental cell research 2007 Dec 10;313(20):4196-207
No comments: Submit comment
No validations: Submit validation data