HPA005575

TFPI antibody from Atlas Antibodies
EPI, LACI, TFI, TFPI1

Antibody data

Product number
HPA005575
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005575, RRID:AB_1080290
Product name
Anti-TFPI
Provider product page
Atlas Antibodies - HPA005575
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFC
FLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLG
NMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVN
NSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.