HPA005575

TFPI antibody from Sigma-Aldrich
EPI, LACI, TFI, TFPI1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005575
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005575, RRID:AB_1080290
Product name
Anti-TFPI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005575
Antibody type
Polyclonal
Antigen
Tissue factor pathway inhibitor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFC
FLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLG
NMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVN
NSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRA
Storage
-20C
Provider Type Product Number
- No reagents -