Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005624-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005624-M01, RRID:AB_490067
- Product name
- PROC monoclonal antibody (M01), clone 3A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PROC.
- Antigen sequence
RAHQVLRIRKRANSFLEELRHSSLERECIEEICDF
EEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPC
ASLCCGHGTCIDGIGSFSCDCRSGWEGRFC- Isotype
- IgG
- Antibody clone number
- 3A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PROC expression in transfected 293T cell line by PROC monoclonal antibody (M01), clone 3A10.Lane 1: PROC transfected lysate (Predicted MW: 52.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PROC transfected lysate using anti-PROC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PROC MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol