HPA024007

SERPINC1 antibody from Sigma-Aldrich
AT3, ATIII, MGC22579
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024007
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024007, RRID:AB_1856732
Product name
Anti-SERPINC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024007
Antibody type
Polyclonal
Antigen
Antithrombin-III Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKE
LFYKADGESCSASMMYQEGKFRYRRVAEGTQVLEL
PFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEW
LDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLV
Storage
-20C
Provider Type Product Number
- No reagents -