HPA017931

AAK1 antibody from Sigma-Aldrich
DKFZp686K16132, KIAA1048
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017931
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017931, RRID:AB_1844406
Product name
Anti-AAK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017931
Antibody type
Polyclonal
Antigen
AP2-associated protein kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGD
AFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFG
STSDAVIGKVIISVSSVMHDMCA
Storage
-20C
Provider Type Product Number
- No reagents -