HPA017931

AAK1 antibody from Atlas Antibodies
DKFZp686K16132, KIAA1048
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017931
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017931, RRID:AB_1844406
Product name
Anti-AAK1
Provider product page
Atlas Antibodies - HPA017931
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGD
AFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFG
STSDAVIGKVIISVSSVMHDMCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -