HPA017931

AAK1 antibody from Atlas Antibodies
DKFZp686K16132, KIAA1048
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017931
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017931, RRID:AB_1233391
Product name
Anti-AAK1
Provider product page
Atlas Antibodies - HPA017931
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGD
AFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFG
STSDAVIGKVIISVSSVMHDMCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -