Antibody data

Product number
H00003684-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003684-M07, RRID:AB_1575629
Product name
ITGAM monoclonal antibody (M07), clone 4E10
Provider product page
Abnova Corporation - H00003684-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ITGAM.
Antigen sequence
QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCP
QEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLV
KPITQ
Isotype
IgG
Antibody clone number
4E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -