H00003551-B01P

IKBKB antibody from Abnova Corporation
IKK-beta, IKK2, IKKB, NFKBIKB

Antibody data

Product number
H00003551-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003551-B01P, RRID:AB_1576259
Product name
IKBKB purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00003551-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IKBKB protein.
Antigen sequence
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQ
ETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH
PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLR
KYLNQFENCCGLREGAILTLLSDIASALRYLHENR
IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQ
GSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT
LAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNP
STLGGRGRWIS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -