Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486965 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Inhibitor of kappa Light Polypeptide Gene Enhancer in B-Cells, Kinase beta (IKBKB) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IKBKB antibody: synthetic peptide directed towards the N terminal of human IKBKB
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDL
NGTVK FSSSLPYPNN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Interleukin-1beta up-regulates RGS4 through the canonical IKK2/IkappaBalpha/NF-kappaB pathway in rabbit colonic smooth muscle.
Hu W, Li F, Mahavadi S, Murthy KS
The Biochemical journal 2008 May 15;412(1):35-43
The Biochemical journal 2008 May 15;412(1):35-43
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: IKBKB Sample Tissue: Human 721_B Antibody Dilution: 1.0 μg/mL IKBKB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells