HPA001249

IKBKB antibody from Sigma-Aldrich
IKK-beta, IKK2, IKKB, NFKBIKB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001249
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001249, RRID:AB_1079126
Product name
Anti-IKBKB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001249
Antibody type
Polyclonal
Antigen
Inhibitor of nuclear factor kappa-B kinase subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTED
ESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDK
PATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQ
ISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Storage
-20C
Provider Type Product Number
- No reagents -