H00064135-B01P

IFIH1 antibody from Abnova Corporation
Hlcd, IDDM19, MDA-5, MDA5

Antibody data

Product number
H00064135-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064135-B01P, RRID:AB_1237850
Product name
IFIH1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064135-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IFIH1 protein.
Antigen sequence
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYL
TFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV
WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSP
SFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME
EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKE
NWFSAFLNVLRQTGNNELVQELTGSDCSESNAGIC
NFTEEDSSNSA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -